PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004508609.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family NF-YB
Protein Properties Length: 146aa    MW: 16733.7 Da    PI: 5.0513
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004508609.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.77.9e-5421116297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     +eqdr+lPianv+rimk++lP+nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal+tlGf+dy+ep++ yl +yrele++
  XP_004508609.1  21 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGTLGFDDYAEPMRRYLIRYRELEAD 115
                     89*******************************************************************************************99 PP

           NF-YB  97 k 97 
                     +
  XP_004508609.1 116 R 116
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.1E-5116135IPR009072Histone-fold
SuperFamilySSF471139.63E-3923132IPR009072Histone-fold
PfamPF008083.3E-272690IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-175472No hitNo description
PROSITE patternPS0068505773IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-177391No hitNo description
PRINTSPR006151.3E-1792110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MMDNNNIGGS TSNNIENGSI KEQDRLLPIA NVGRIMKQIL PQNAKISKES KETMQECVSE  60
FISFVTSEAS EKCRKERRKT VNGDDICWAL GTLGFDDYAE PMRRYLIRYR ELEADRNTNN  120
INVQDRGNSP QENDHELFMF PPRGSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4420111192Transcription factor HapC (Eurofung)
4g92_B1e-4420111192Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743711e-114AC174371.23 Medicago truncatula chromosome 8 clone mth2-50f21, complete sequence.
GenBankBT1370511e-114BT137051.1 Medicago truncatula clone JCVI-FLMt-1H17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004508609.11e-106PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822481e-54NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLG7JKC31e-74G7JKC3_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA07G37840.24e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.14e-55nuclear factor Y, subunit B5